🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

RAB27B

BeschreibungRas-related protein Rab-27B

Gene and Protein Information

Gene ID5874
Uniprot Accession IDs O00194 B2RAB0 Q9BZB6
Ensembl ID ENSP00000262094
Symbol C25KG
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp468542RAB27BRAB27B, member RAS oncogene family9598VGNC:13277OMA, EggNOG
Mouse80718Rab27bRAB27B, member RAS oncogene family10090MGI:1931295Inparanoid, OMA, EggNOG
Rat84590Rab27bRAB27B, member RAS oncogene family10116RGD:620114Inparanoid, OMA, EggNOG
Dog483974RAB27BRAB27B, member RAS oncogene family9615VGNC:45268Inparanoid, OMA, EggNOG
Horse100049861RAB27BRAB27B, member RAS oncogene family9796VGNC:22101Inparanoid, OMA, EggNOG
Cow282858RAB27BRAB27B, member RAS oncogene family9913VGNC:33634Inparanoid, OMA, EggNOG
Opossum100016702RAB27BRAB27B, member RAS oncogene family13616Inparanoid, OMA, EggNOG
Platypus100078959RAB27BRAB27B, member RAS oncogene family9258Inparanoid, OMA, EggNOG
Anole lizard100558750rab27bRAB27B, member RAS oncogene family28377Inparanoid, OMA
Xenopus448182rab27bRAB27B, member RAS oncogene family8364XB-GENE-491764Inparanoid, OMA
C. elegans173223aex-6hypothetical protein6239Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.