Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Reticulon-4 receptor-like 1 |
|---|
Gene and Protein Information
| Gene ID | 146760 |
|---|---|
| Uniprot Accession IDs | Q86UN2 A1A5E3 Q8ND46 |
| Ensembl ID | ENSP00000330631 |
| Symbol | NGRH2 NGRL2 NgR3 NGRH2 |
| Family | Belongs to the Nogo receptor family. |
| Sequence | MLRKGCCVELLLLLVAAELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSASSLGASLLAWTLGLAVTLR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468138 | RTN4RL1 | reticulon 4 receptor like 1 | 9598 | VGNC:9581 | OMA, EggNOG |
| Mouse | 237847 | Rtn4rl1 | reticulon 4 receptor-like 1 | 10090 | MGI:2661375 | Inparanoid, OMA, EggNOG |
| Rat | 303311 | Rtn4rl1 | reticulon 4 receptor-like 1 | 10116 | RGD:727812 | Inparanoid, OMA, EggNOG |
| Dog | 491197 | RTN4RL1 | reticulon 4 receptor like 1 | 9615 | VGNC:45797 | Inparanoid, OMA |
| Horse | RTN4RL1 | reticulon 4 receptor like 1 [Source:HGNC Symbol;Acc:HGNC:21329] | 9796 | OMA, EggNOG | ||
| Cow | 539358 | RTN4RL1 | reticulon 4 receptor like 1 | 9913 | VGNC:34207 | Inparanoid, OMA, EggNOG |
| Opossum | 100018469 | RTN4RL1 | reticulon 4 receptor like 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100555946 | rtn4rl1 | reticulon 4 receptor like 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | rtn4rl1 | reticulon 4 receptor-like 1 [Source:Xenbase;Acc:XB-GENE-961465] | 8364 | OMA, EggNOG | ||
| Zebrafish | rtn4rl1a | reticulon 4 receptor-like 1a | 7955 | ZDB-GENE-091118-38 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.