🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

RAVER2

BeschreibungRibonucleoprotein PTB-binding 2

Gene and Protein Information

Gene ID55225
Uniprot Accession IDs Q9HCJ3 Q6P141 Q9NPV7
Ensembl ID ENSP00000360112
Symbol KIAA1579
Sequence
MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYSTAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQQLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp469344RAVER2ribonucleoprotein, PTB binding 29598VGNC:10033OMA, EggNOG
Macaque701724RAVER2ribonucleoprotein, PTB binding 29544Inparanoid, OMA, EggNOG
Mouse242570Raver2ribonucleoprotein, PTB-binding 210090MGI:2443623Inparanoid, OMA
Rat362551Raver2ribonucleoprotein, PTB-binding 210116RGD:1307610Inparanoid, OMA
Dog489556RAVER2ribonucleoprotein, PTB binding 29615VGNC:45387Inparanoid, OMA
Horse100069778RAVER2ribonucleoprotein, PTB binding 29796VGNC:22217Inparanoid, OMA
Cow522059RAVER2ribonucleoprotein, PTB binding 29913VGNC:33766Inparanoid, OMA, EggNOG
Opossum100031320RAVER2ribonucleoprotein, PTB binding 213616Inparanoid, OMA, EggNOG
Anole lizard100559526raver2ribonucleoprotein, PTB binding 228377Inparanoid, OMA
Xenopus780311raver2ribonucleoprotein, PTB binding 28364XB-GENE-919935Inparanoid, OMA, EggNOG
Zebrafish797613raver2ribonucleoprotein, PTB-binding 27955ZDB-GENE-090713-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Ribonucleoprotein PTB-binding 2
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Ribonucleoprotein PTB-binding 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.