Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Receptor-binding cancer antigen expressed on SiSo cells |
|---|
Gene and Protein Information
| Gene ID | 9166 |
|---|---|
| Uniprot Accession IDs | O00559 A8K3N6 Q5Y8C7 Q6IB20 Q9BS76 |
| Ensembl ID | ENSP00000337675 |
| Symbol | RCAS1 EB9 PDAF |
| Sequence | MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464339 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 9598 | OMA, EggNOG | |
| Macaque | 699305 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 55960 | Ebag9 | estrogen receptor-binding fragment-associated gene 9 | 10090 | MGI:1859920 | Inparanoid, OMA, EggNOG |
| Rat | 299864 | Ebag9 | estrogen receptor binding site associated, antigen, 9 | 10116 | RGD:1307293 | Inparanoid, OMA |
| Dog | 403500 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 9615 | VGNC:40174 | Inparanoid, OMA, EggNOG |
| Horse | 100064267 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 9796 | VGNC:17395 | Inparanoid, OMA, EggNOG |
| Cow | 538551 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100156275 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 9823 | OMA, EggNOG | |
| Opossum | 100024590 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 13616 | OMA, EggNOG | |
| Platypus | 100075604 | EBAG9 | estrogen receptor binding site associated, antigen, 9 | 9258 | OMA, EggNOG | |
| Anole lizard | 100566802 | ebag9 | estrogen receptor binding site associated, antigen, 9 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549842 | ebag9 | estrogen receptor binding site associated, antigen, 9 | 8364 | XB-GENE-996539 | Inparanoid, OMA, EggNOG |
| Zebrafish | 394069 | ebag9 | estrogen receptor binding site associated, antigen, 9 | 7955 | ZDB-GENE-040426-1093 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.