🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Retinoic acid receptor gamma |
|---|
Gene and Protein Information
| Gene ID | 5916 |
|---|---|
| Uniprot Accession IDs | P13631 B7Z492 B7Z4F1 B7ZAE4 J3KNP6 P22932 Q15281 Q52LZ8 Q9BYX8 Q9H1I3 Q9UJ38 RAR-gamma |
| Ensembl ID | ENSP00000388510 |
| Symbol | NR1B3 RARC NR1B3 |
| Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Sequence | MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451935 | RARG | retinoic acid receptor gamma | 9598 | VGNC:8514 | OMA, EggNOG |
| Macaque | 699532 | RARG | retinoic acid receptor gamma | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19411 | Rarg | retinoic acid receptor, gamma | 10090 | MGI:97858 | Inparanoid, OMA, EggNOG |
| Rat | 685072 | Rarg | retinoic acid receptor, gamma | 10116 | RGD:1583230 | Inparanoid, OMA |
| Dog | 486508 | RARG | retinoic acid receptor gamma | 9615 | VGNC:45353 | Inparanoid, OMA |
| Horse | 100062026 | RARG | retinoic acid receptor gamma | 9796 | VGNC:22186 | Inparanoid, OMA |
| Cow | 540425 | RARG | retinoic acid receptor gamma | 9913 | VGNC:33730 | Inparanoid, OMA |
| Pig | 100626982 | RARG | retinoic acid receptor gamma | 9823 | Inparanoid, OMA | |
| Anole lizard | 100555055 | rarg | retinoic acid receptor gamma | 28377 | Inparanoid, OMA | |
| Xenopus | 100485387 | rarg | retinoic acid receptor gamma | 8364 | XB-GENE-484127 | Inparanoid, OMA |
| Zebrafish | 100034753 | rargb | retinoic acid receptor, gamma b | 7955 | ZDB-GENE-070314-1 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.