PRLHR

BeschreibungProlactin-releasing peptide receptor

Gene and Protein Information

Gene ID2834
Uniprot Accession IDs P49683 O75194 Q502U8 Q5VXR9 PrRP receptor
Ensembl ID ENSP00000239032
Symbol GPR10 GR3 GR3 GPR10 PrRPR
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp466259PRLHRprolactin releasing hormone receptor9598VGNC:5707OMA, EggNOG
Mouse226278Prlhrprolactin releasing hormone receptor10090MGI:2135956Inparanoid, OMA, EggNOG
Rat246075Prlhrprolactin releasing hormone receptor10116RGD:71037Inparanoid, OMA, EggNOG
Dog486911PRLHRprolactin releasing hormone receptor9615VGNC:44993Inparanoid, OMA, EggNOG
Horse100066425PRLHRprolactin releasing hormone receptor9796VGNC:21856Inparanoid, OMA, EggNOG
Cow510397PRLHRprolactin releasing hormone receptor9913VGNC:33345Inparanoid, OMA, EggNOG
Anole lizardPRLHRprolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464]28377Inparanoid, OMA
Fruitfly40195sNPF-Rshort neuropeptide F receptor7227FBgn0036934Inparanoid, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Prolactin-releasing peptide receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.