🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

PRLHR

BeschreibungProlactin-releasing peptide receptor

Gene and Protein Information

Gene ID2834
Uniprot Accession IDs P49683 O75194 Q502U8 Q5VXR9 PrRP receptor
Ensembl ID ENSP00000239032
Symbol GPR10 GR3 GR3 GPR10 PrRPR
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp466259PRLHRprolactin releasing hormone receptor9598VGNC:5707OMA, EggNOG
Mouse226278Prlhrprolactin releasing hormone receptor10090MGI:2135956Inparanoid, OMA, EggNOG
Rat246075Prlhrprolactin releasing hormone receptor10116RGD:71037Inparanoid, OMA, EggNOG
Dog486911PRLHRprolactin releasing hormone receptor9615VGNC:44993Inparanoid, OMA, EggNOG
Horse100066425PRLHRprolactin releasing hormone receptor9796VGNC:21856Inparanoid, OMA, EggNOG
Cow510397PRLHRprolactin releasing hormone receptor9913VGNC:33345Inparanoid, OMA, EggNOG
Anole lizardPRLHRprolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464]28377Inparanoid, OMA
Fruitfly40195sNPF-Rshort neuropeptide F receptor7227FBgn0036934Inparanoid, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Prolactin-releasing peptide receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.