🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

QPCT

BeschreibungGlutaminyl-peptide cyclotransferase

Gene and Protein Information

Gene ID25797
Uniprot Accession IDs Q16769 Q16770 Q3KRG6 Q53TR4
Ensembl ID ENSP00000344829
Symbol QC GCT sQC
FamilyBelongs to the glutaminyl-peptide cyclotransferase family.
Sequence
MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp744549QPCTglutaminyl-peptide cyclotransferase9598VGNC:377OMA, EggNOG
Macaque712233QPCTglutaminyl-peptide cyclotransferase9544Inparanoid, OMA, EggNOG
Mouse70536Qpctglutaminyl-peptide cyclotransferase (glutaminyl cyclase)10090MGI:1917786Inparanoid, OMA, EggNOG
Dog403861QPCTglutaminyl-peptide cyclotransferase9615VGNC:45233Inparanoid, OMA, EggNOG
Horse100070174QPCTglutaminyl-peptide cyclotransferase9796VGNC:22071Inparanoid, OMA, EggNOG
Cow281437QPCTglutaminyl-peptide cyclotransferase9913VGNC:33598Inparanoid, OMA, EggNOG
Pig397424QPCTglutaminyl-peptide cyclotransferase9823Inparanoid, OMA, EggNOG
Opossum100012208QPCTglutaminyl-peptide cyclotransferase13616Inparanoid, EggNOG
Platypus100077983QPCTglutaminyl-peptide cyclotransferase9258Inparanoid, OMA, EggNOG
Anole lizard100563262qpctglutaminyl-peptide cyclotransferase28377Inparanoid, OMA, EggNOG
Xenopus549999qpctglutaminyl-peptide cyclotransferase8364XB-GENE-953343Inparanoid, OMA, EggNOG
Zebrafish795685qpctglutaminyl-peptide cyclotransferase7955ZDB-GENE-130827-1OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.