🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

PSMB2

BeschreibungProteasome subunit beta type-2

Gene and Protein Information

Gene ID5690
Uniprot Accession IDs P49721 D3DPS0 P31145 Q9BWZ9
Ensembl ID ENSP00000362334
Symbol HC7-I
FamilyBelongs to the peptidase T1B family.
Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp469277PSMB2proteasome subunit beta 29598VGNC:11806Inparanoid, OMA, EggNOG
Macaque712193PSMB2proteasome subunit beta 29544Inparanoid, OMA, EggNOG
Mouse26445Psmb2proteasome (prosome, macropain) subunit, beta type 210090MGI:1347045Inparanoid, OMA, EggNOG
Rat29675Psmb2proteasome subunit beta 210116RGD:61874Inparanoid, OMA, EggNOG
Dog475338PSMB2proteasome subunit beta 29615VGNC:45095Inparanoid, OMA, EggNOG
Horse100055325PSMB2proteasome subunit beta 29796VGNC:21941Inparanoid, OMA, EggNOG
Cow516919PSMB2proteasome subunit beta 29913VGNC:33446Inparanoid, OMA, EggNOG
Platypus100077529PSMB2proteasome subunit beta 29258Inparanoid, OMA, EggNOG
Chicken419630PSMB2proteasome subunit beta 29031CGNC:66347Inparanoid, OMA
Anole lizard100566839psmb2proteasome subunit beta 228377Inparanoid, OMA, EggNOG
Xenopus496467psmb2proteasome subunit beta 28364XB-GENE-946101Inparanoid, OMA, EggNOG
Zebrafish436882psmb2proteasome subunit beta 27955ZDB-GENE-040718-353Inparanoid, OMA, EggNOG
C. elegans171975pbs-4Proteasome subunit beta type-26239Inparanoid, OMA
S.cerevisiae856731PRE1proteasome core particle subunit beta 44932S000000814Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.