🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

HCRTR1

BeschreibungOrexin receptor type 1

Gene and Protein Information

Gene ID3061
Uniprot Accession IDs O43613 A8K3A6 Q9HBV6 Ox-1-R
Ensembl ID ENSP00000384387
Symbol OX1R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp469261HCRTR1hypocretin receptor 19598VGNC:8049OMA, EggNOG
Macaque705914HCRTR1hypocretin receptor 19544Inparanoid, OMA, EggNOG
Mouse230777Hcrtr1hypocretin (orexin) receptor 110090MGI:2385650Inparanoid, OMA, EggNOG
Rat25593Hcrtr1hypocretin receptor 110116RGD:2787Inparanoid, OMA, EggNOG
Dog100855896HCRTR1hypocretin receptor 19615VGNC:41623Inparanoid, OMA, EggNOG
Horse100056164HCRTR1hypocretin receptor 19796VGNC:18714Inparanoid, OMA
Cow282248HCRTR1hypocretin receptor 19913VGNC:29781Inparanoid, OMA, EggNOG
Pig387287HCRTR1hypocretin receptor 19823OMA, EggNOG
Platypus100075542HCRTR1hypocretin receptor 19258Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Orexin receptor type 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Orexin receptor type 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.