🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

PAWR

BeschreibungPRKC apoptosis WT1 regulator protein

Gene and Protein Information

Gene ID5074
Uniprot Accession IDs Q96IZ0 O75796 Q6FHY9 Q8N700
Ensembl ID ENSP00000328088
Symbol PAR4 PAR4 Par-4
Sequence
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp452094PAWRpro-apoptotic WT1 regulator9598VGNC:8489OMA, EggNOG
Macaque695617PAWRpro-apoptotic WT1 regulator9544Inparanoid, OMA, EggNOG
Mouse114774PawrPRKC, apoptosis, WT1, regulator10090MGI:2149961Inparanoid, OMA, EggNOG
Rat64513Pawrpro-apoptotic WT1 regulator10116RGD:69065Inparanoid, OMA, EggNOG
OpossumPAWRpro-apoptotic WT1 regulator [Source:HGNC Symbol;Acc:HGNC:8614]13616Inparanoid, OMA, EggNOG
Chicken417870PAWRpro-apoptotic WT1 regulator9031CGNC:7853Inparanoid, OMA
Xenopus100486624pawrPRKC, apoptosis, WT1, regulator8364XB-GENE-987162Inparanoid, OMA, EggNOG
Zebrafish449994pawrPRKC, apoptosis, WT1, regulator7955ZDB-GENE-041010-108Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.