🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

CNR2

BeschreibungCannabinoid receptor 2

Gene and Protein Information

Gene ID1269
Uniprot Accession IDs P34972 C6ES44 Q4VBK8 Q5JRH7 Q6B0G7 Q6NSY0 CB-2
Ensembl ID ENSP00000363596
Symbol CB2A CB2B CB2 CX5 CB-2
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp456625CNR2cannabinoid receptor 29598VGNC:6114OMA, EggNOG
Macaque711155CNR2cannabinoid receptor 29544Inparanoid, OMA, EggNOG
Mouse12802Cnr2cannabinoid receptor 2 (macrophage)10090MGI:104650Inparanoid, OMA, EggNOG
Rat57302Cnr2cannabinoid receptor 210116RGD:619713Inparanoid, OMA, EggNOG
Dog612289CNR2cannabinoid receptor 29615VGNC:39427Inparanoid, OMA, EggNOG
Horse100071536CNR2cannabinoid receptor 29796VGNC:16688Inparanoid, OMA, EggNOG
Cow539769CNR2cannabinoid receptor 29913VGNC:27530Inparanoid, OMA, EggNOG
Pig100621002CNR2cannabinoid receptor 29823OMA, EggNOG
Opossum100010312CNR2cannabinoid receptor 213616Inparanoid, OMA, EggNOG
Platypus100091779CNR2cannabinoid receptor 29258Inparanoid, OMA, EggNOG
Chicken428232CNR2cannabinoid receptor 29031CGNC:3023Inparanoid, EggNOG
Anole lizard100563830cnr2cannabinoid receptor 228377Inparanoid, OMA, EggNOG
Xenopus100498271cnr2cannabinoid receptor 28364XB-GENE-488004Inparanoid, OMA, EggNOG
Zebrafish795246cnr2cannabinoid receptor 27955ZDB-GENE-040702-7OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Cannabinoid receptor 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Cannabinoid receptor    /    Cannabinoid receptor 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.