🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

PROK2

BeschreibungProkineticin-2

Gene and Protein Information

Gene ID60675
Uniprot Accession IDs Q9HC23 Q53Z79 Q6ISR0 PK2
Ensembl ID ENSP00000295619
Symbol BV8 BV8 HH4 PK2 KAL4 MIT1
FamilyBelongs to the AVIT (prokineticin) family.
Sequence
MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp736902PROK2prokineticin 29598VGNC:2524OMA, EggNOG
Macaque694450PROK2prokineticin 29544Inparanoid, OMA, EggNOG
Mouse50501Prok2prokineticin 210090MGI:1354178Inparanoid, OMA, EggNOG
Rat192206Prok2prokineticin 210116RGD:620280Inparanoid, OMA, EggNOG
Cow387602PROK2prokineticin 29913VGNC:33362Inparanoid, OMA, EggNOG
Pig100526076PROK2prokineticin 29823OMA, EggNOG
Opossum100020601PROK2prokineticin 213616Inparanoid, OMA, EggNOG
Chicken771674PROK2prokineticin 29031CGNC:5886Inparanoid, EggNOG
Anole lizardPROK2prokineticin 2 [Source:HGNC Symbol;Acc:HGNC:18455]28377Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    Prokineticin-2
DTO Classes
protein    /    Signaling    /    Hormone    /    Prokineticin-2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.