CDC40

BeschreibungPre-mRNA-processing factor 17

Gene and Protein Information

Gene ID51362
Uniprot Accession IDs O60508 B2RBC5 O75471 Q5SRN0 Q9UPG1
Ensembl ID ENSP00000357928
Symbol EHB3 PRP17 PRPF17 EHB3 PRP17 PRPF17
Sequence
MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp462936CDC40cell division cycle 409598VGNC:2657OMA, EggNOG
Macaque697474CDC40cell division cycle 409544Inparanoid, OMA, EggNOG
Mouse71713Cdc40cell division cycle 4010090MGI:1918963Inparanoid, OMA, EggNOG
Rat361859Cdc40cell division cycle 4010116RGD:1307063Inparanoid, OMA
Dog475025CDC40cell division cycle 409615VGNC:38996Inparanoid, OMA, EggNOG
Horse100066771CDC40cell division cycle 409796VGNC:16295Inparanoid, OMA, EggNOG
Cow514003CDC40cell division cycle 409913VGNC:27068Inparanoid, OMA, EggNOG
Pig100511111CDC40cell division cycle 409823Inparanoid, OMA, EggNOG
Opossum100022119CDC40cell division cycle 4013616Inparanoid, OMA, EggNOG
PlatypusCDC40cell division cycle 40 [Source:HGNC Symbol;Acc:HGNC:17350]9258OMA, EggNOG
Chicken421760CDC40cell division cycle 409031CGNC:11202Inparanoid, OMA, EggNOG
Xenopus496947cdc40cell division cycle 408364XB-GENE-954563Inparanoid, OMA, EggNOG
Zebrafish494534cdc40cell division cycle 40 homolog (S. cerevisiae)7955ZDB-GENE-050116-3Inparanoid, OMA, EggNOG
C. elegans172999prp-17yeast PRP (splicing factor) related6239Inparanoid, OMA
Fruitfly42593CG6015CG6015 gene product from transcript CG6015-RA7227FBgn0038927Inparanoid, EggNOG
S.cerevisiae851968CDC40Cdc40p4932S000002772Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Pre-mRNA-processing factor 17
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Pre-mRNA-processing factor 17

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.