🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Pre-mRNA-processing factor 17 |
|---|
Gene and Protein Information
| Gene ID | 51362 |
|---|---|
| Uniprot Accession IDs | O60508 B2RBC5 O75471 Q5SRN0 Q9UPG1 |
| Ensembl ID | ENSP00000357928 |
| Symbol | EHB3 PRP17 PRPF17 EHB3 PRP17 PRPF17 |
| Sequence | MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462936 | CDC40 | cell division cycle 40 | 9598 | VGNC:2657 | OMA, EggNOG |
| Macaque | 697474 | CDC40 | cell division cycle 40 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 71713 | Cdc40 | cell division cycle 40 | 10090 | MGI:1918963 | Inparanoid, OMA, EggNOG |
| Rat | 361859 | Cdc40 | cell division cycle 40 | 10116 | RGD:1307063 | Inparanoid, OMA |
| Dog | 475025 | CDC40 | cell division cycle 40 | 9615 | VGNC:38996 | Inparanoid, OMA, EggNOG |
| Horse | 100066771 | CDC40 | cell division cycle 40 | 9796 | VGNC:16295 | Inparanoid, OMA, EggNOG |
| Cow | 514003 | CDC40 | cell division cycle 40 | 9913 | VGNC:27068 | Inparanoid, OMA, EggNOG |
| Pig | 100511111 | CDC40 | cell division cycle 40 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100022119 | CDC40 | cell division cycle 40 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CDC40 | cell division cycle 40 [Source:HGNC Symbol;Acc:HGNC:17350] | 9258 | OMA, EggNOG | ||
| Chicken | 421760 | CDC40 | cell division cycle 40 | 9031 | CGNC:11202 | Inparanoid, OMA, EggNOG |
| Xenopus | 496947 | cdc40 | cell division cycle 40 | 8364 | XB-GENE-954563 | Inparanoid, OMA, EggNOG |
| Zebrafish | 494534 | cdc40 | cell division cycle 40 homolog (S. cerevisiae) | 7955 | ZDB-GENE-050116-3 | Inparanoid, OMA, EggNOG |
| C. elegans | 172999 | prp-17 | yeast PRP (splicing factor) related | 6239 | Inparanoid, OMA | |
| Fruitfly | 42593 | CG6015 | CG6015 gene product from transcript CG6015-RA | 7227 | FBgn0038927 | Inparanoid, EggNOG |
| S.cerevisiae | 851968 | CDC40 | Cdc40p | 4932 | S000002772 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Pre-mRNA-processing factor 17
protein / nucleic acid binding / mRNA splicing factor / Pre-mRNA-processing factor 17
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Pre-mRNA-processing factor 17
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Pre-mRNA-processing factor 17
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.