🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

SGK2

BeschreibungSerine/threonine-protein kinase Sgk2

Gene and Protein Information

Gene ID10110
Uniprot Accession IDs Q9HBY8 Q52PK5 Q5H8Y6 Q5H8Z1 Q5TZR3 Q9UKG6
Ensembl ID ENSP00000340608
Symbol H-SGK2 dJ138B7.2
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Sequence
MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp740699SGK2SGK2, serine/threonine kinase 29598VGNC:10267OMA, EggNOG
Macaque695356SGK2SGK2, serine/threonine kinase 29544Inparanoid, OMA, EggNOG
Mouse27219Sgk2serum/glucocorticoid regulated kinase 210090MGI:1351318Inparanoid, OMA, EggNOG
Rat171497Sgk2SGK2, serine/threonine kinase 210116RGD:620232Inparanoid, OMA, EggNOG
Horse100147213SGK2SGK2, serine/threonine kinase 29796VGNC:22917Inparanoid, OMA, EggNOG
Cow517909SGK2SGK2, serine/threonine kinase 29913VGNC:34542Inparanoid, OMA, EggNOG
Pig100157757SGK2SGK2, serine/threonine kinase 29823OMA, EggNOG
Opossum100032629SGK2SGK2, serine/threonine kinase 213616Inparanoid, EggNOG
Chicken419166SGK2SGK2, serine/threonine kinase 29031CGNC:2582Inparanoid, OMA, EggNOG
Anole lizard100566896sgk2SGK2, serine/threonine kinase 228377Inparanoid, OMA, EggNOG
Xenopus100036607sgk2serum/glucocorticoid regulated kinase 28364XB-GENE-982512Inparanoid, OMA, EggNOG
Zebrafish570956sgk2aserum/glucocorticoid regulated kinase 2a7955ZDB-GENE-030131-9632OMA, EggNOG
C. elegans181697sgk-1Serine/threonine-protein kinase sgk-16239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    non-receptor serine/threonine protein kinase    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    transfer/carrier protein    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    protein kinase    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    calmodulin    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    transferase    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    annexin    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    kinase    /    Serine/threonine-protein kinase sgk2
DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    SGK family    /    Serine/threonine-protein kinase sgk2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.