Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | U1 small nuclear ribonucleoprotein C |
|---|
Gene and Protein Information
| Gene ID | 6631 |
|---|---|
| Uniprot Accession IDs | P09234 Q5TAL3 U1 snRNP C |
| Ensembl ID | ENSP00000244520 |
| Symbol | U1C Yhc1 |
| Family | Belongs to the U1 small nuclear ribonucleoprotein C family. |
| Sequence | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 747404 | SNRPC | small nuclear ribonucleoprotein polypeptide C | 9598 | VGNC:11300 | OMA, EggNOG |
| Macaque | 718654 | SNRPC | small nuclear ribonucleoprotein polypeptide C | 9544 | OMA, EggNOG | |
| Mouse | 20630 | Snrpc | U1 small nuclear ribonucleoprotein C | 10090 | MGI:109489 | Inparanoid, OMA, EggNOG |
| Rat | 361808 | Snrpc | small nuclear ribonucleoprotein polypeptide C | 10116 | RGD:1306065 | Inparanoid, OMA, EggNOG |
| Horse | 100053207 | SNRPC | small nuclear ribonucleoprotein polypeptide C | 9796 | VGNC:23397 | Inparanoid, OMA, EggNOG |
| Cow | 614553 | SNRPC | small nuclear ribonucleoprotein polypeptide C | 9913 | VGNC:35078 | Inparanoid, OMA, EggNOG |
| Pig | 100154606 | SNRPC | small nuclear ribonucleoprotein polypeptide C | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100028059 | SNRPC | small nuclear ribonucleoprotein polypeptide C | 13616 | OMA, EggNOG | |
| Platypus | SNRPC | small nuclear ribonucleoprotein polypeptide C [Source:HGNC Symbol;Acc:HGNC:11157] | 9258 | OMA, EggNOG | ||
| Chicken | 419901 | SNRPC | small nuclear ribonucleoprotein polypeptide C | 9031 | CGNC:2000 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552525 | snrpc | small nuclear ribonucleoprotein polypeptide C | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549352 | snrpc | small nuclear ribonucleoprotein polypeptide C | 8364 | XB-GENE-495092 | Inparanoid, OMA, EggNOG |
| Zebrafish | 192330 | snrpc | small nuclear ribonucleoprotein polypeptide C | 7955 | ZDB-GENE-020419-26 | Inparanoid, OMA |
| C. elegans | 177674 | F08B4.7 | U1 small nuclear ribonucleoprotein C | 6239 | Inparanoid, OMA | |
| Fruitfly | 42274 | snRNP-U1-C | small ribonucleoprotein particle U1 subunit C | 7227 | FBgn0261792 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.