🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

S100A2

BeschreibungProtein S100-A2

Gene and Protein Information

Gene ID6273
Uniprot Accession IDs P29034 O00266 Q3KRB9 Q5RHS8 Q9BU83
Ensembl ID ENSP00000357697
Symbol S100L CAN19 S100L
FamilyBelongs to the S-100 family.
Sequence
MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp457321S100A2S100 calcium binding protein A29598VGNC:53220OMA, EggNOG
Macaque715264S100A2S100 calcium binding protein A29544OMA, EggNOG
Dog612326S100A2S100 calcium binding protein A29615VGNC:45828Inparanoid, OMA, EggNOG
Horse100056230S100A2S100 calcium binding protein A29796VGNC:50881Inparanoid, OMA, EggNOG
Cow509860S100A2S100 calcium binding protein A29913VGNC:34242Inparanoid, OMA, EggNOG
Platypus100093329S100A2S100 calcium binding protein A29258Inparanoid, OMA, EggNOG
Zebrafish100005083icn2ictacalcin 27955ZDB-GENE-070822-9Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-A2
protein    /    calcium-binding protein    /    growth factor    /    Protein S100-A2
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-A2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.