🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

TUBB1

BeschreibungTubulin beta-1 chain

Gene and Protein Information

Gene ID81027
Uniprot Accession IDs Q9H4B7
Ensembl ID ENSP00000217133
FamilyBelongs to the tubulin family.
Sequence
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp736308TUBB1tubulin beta 1 class VI9598VGNC:10060OMA, EggNOG
Macaque693889TUBB1tubulin beta 1 class VI9544Inparanoid, OMA, EggNOG
Mouse545486Tubb1tubulin, beta 1 class VI10090MGI:107814Inparanoid, OMA, EggNOG
Rat679312Tubb1tubulin, beta 1 class VI10116RGD:1589557OMA, EggNOG
Dog485950TUBB1tubulin beta 1 class VI9615VGNC:49697Inparanoid, OMA, EggNOG
Horse100056684TUBB1tubulin beta 1 class VI9796VGNC:24657Inparanoid, OMA, EggNOG
Cow541271TUBB1tubulin beta 1 class VI9913VGNC:36506Inparanoid, OMA, EggNOG
Pig100134983TUBB1tubulin beta 1 class VI9823Inparanoid, OMA, EggNOG
Opossum100027039TUBB1tubulin beta 1 class VI13616Inparanoid, EggNOG
PlatypusTUBB1tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257]9258OMA, EggNOG
Chicken396427TUBB1tubulin beta 1 class VI9031CGNC:49797OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    tubulin    /    Tubulin beta-1 chain
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Tubulin    /    Tubulin beta-1 chain

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.