🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

S100B

BeschreibungProtein S100-B

Gene and Protein Information

Gene ID6285
Uniprot Accession IDs P04271 D3DSN6
Ensembl ID ENSP00000291700
Symbol NEF S100 S100-B S100beta
FamilyBelongs to the S-100 family.
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp474141S100BS100 calcium binding protein B9598VGNC:1125OMA, EggNOG
Macaque708117S100BS100 calcium binding protein B9544Inparanoid, OMA, EggNOG
Mouse20203S100bS100 protein, beta polypeptide, neural10090MGI:98217Inparanoid, OMA, EggNOG
Rat25742S100bS100 calcium binding protein B10116RGD:3615Inparanoid, OMA, EggNOG
Dog491615S100BS100 calcium binding protein B9615VGNC:49642Inparanoid, OMA, EggNOG
Horse100054841S100BS100 calcium binding protein B9796VGNC:22656Inparanoid, OMA, EggNOG
Cow525716S100BS100 calcium binding protein B9913VGNC:34248Inparanoid, OMA, EggNOG
Pig100623510S100BS100 calcium binding protein B9823OMA, EggNOG
PlatypusS100BS100 calcium binding protein B [Source:HGNC Symbol;Acc:HGNC:10500]9258OMA, EggNOG
Chicken424038S100BS100 calcium binding protein B9031CGNC:4668Inparanoid, OMA, EggNOG
Zebrafish436825s100bS100 calcium binding protein, beta (neural)7955ZDB-GENE-040718-290Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-B
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-B
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-B

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.