🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

SRA1

BeschreibungSteroid receptor RNA activator 1

Gene and Protein Information

Gene ID10011
Uniprot Accession IDs Q9HD15 Q6NVU9 Q8IXM1 Q9HD13 Q9HD14
Ensembl ID ENSP00000337513
Symbol SRA SRAP STRAA1 pp7684
FamilyBelongs to the SRA1 family.
Sequence
MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp737402SRA1steroid receptor RNA activator 19598VGNC:4181OMA, EggNOG
Macaque698169SRA1steroid receptor RNA activator 19544Inparanoid, OMA, EggNOG
Mouse24068Sra1steroid receptor RNA activator 110090MGI:1344414Inparanoid, EggNOG
Rat252891Sra1steroid receptor RNA activator 110116RGD:621148Inparanoid, OMA, EggNOG
Dog606944SRA1steroid receptor RNA activator 19615VGNC:46788Inparanoid, OMA, EggNOG
Horse100072416SRA1steroid receptor RNA activator 19796VGNC:23568Inparanoid, OMA, EggNOG
Cow780787SRA1steroid receptor RNA activator 19913VGNC:35266Inparanoid, OMA, EggNOG
Pig100513784SRA1steroid receptor RNA activator 19823OMA, EggNOG
Anole lizard100561561sra1steroid receptor RNA activator 128377Inparanoid, OMA, EggNOG
Xenopus100135196sra1steroid receptor RNA activator 18364XB-GENE-994039Inparanoid, OMA, EggNOG
Zebrafish415137sra1steroid receptor RNA activator 17955ZDB-GENE-040625-6Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.