Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Radical S-adenosyl methionine domain-containing protein 2 |
|---|
Gene and Protein Information
| Gene ID | 91543 |
|---|---|
| Uniprot Accession IDs | Q8WXG1 Q8WVI4 |
| Ensembl ID | ENSP00000371471 |
| Symbol | CIG5 cig5 vig1 cig33 2510004L01Rik |
| Family | Belongs to the radical SAM superfamily. RSAD2 family. |
| Sequence | MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459006 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9598 | VGNC:10754 | OMA, EggNOG |
| Macaque | 708720 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 58185 | Rsad2 | radical S-adenosyl methionine domain containing 2 | 10090 | MGI:1929628 | Inparanoid, OMA, EggNOG |
| Rat | 65190 | Rsad2 | radical S-adenosyl methionine domain containing 2 | 10116 | RGD:620495 | Inparanoid, OMA, EggNOG |
| Dog | 609005 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9615 | VGNC:45770 | Inparanoid, OMA, EggNOG |
| Horse | 100072610 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9796 | VGNC:22595 | Inparanoid, OMA, EggNOG |
| Cow | 506415 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9913 | VGNC:34176 | Inparanoid, OMA, EggNOG |
| Pig | 396752 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | RSAD2 | radical S-adenosyl methionine domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30908] | 13616 | Inparanoid, EggNOG | ||
| Platypus | 100080030 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 428650 | RSAD2 | radical S-adenosyl methionine domain containing 2 | 9031 | CGNC:12277 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565093 | rsad2 | radical S-adenosyl methionine domain containing 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100493449 | rsad2 | radical S-adenosyl methionine domain containing 2 | 8364 | XB-GENE-485892 | Inparanoid, OMA, EggNOG |
| Zebrafish | 570456 | rsad2 | radical S-adenosyl methionine domain containing 2 | 7955 | ZDB-GENE-050913-129 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.