🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Heterogeneous nuclear ribonucleoprotein A1 |
|---|
Gene and Protein Information
| Gene ID | 3178 |
|---|---|
| Uniprot Accession IDs | P09651 A8K4Z8 Q3MIB7 Q6PJZ7 hnRNP A1 |
| Ensembl ID | ENSP00000341826 |
| Symbol | HNRPA1 UP 1 ALS19 ALS20 HNRPA1 IBMPFD3 HNRPA1L3 hnRNP A1 hnRNP-A1 |
| Sequence | MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Rat | 29578 | Hnrnpa1 | heterogeneous nuclear ribonucleoprotein A1 | 10116 | RGD:69234 | OMA, EggNOG |
| Horse | 100034153 | HNRNPA1 | heterogeneous nuclear ribonucleoprotein A1 | 9796 | Inparanoid, OMA, EggNOG | |
| Pig | 768103 | HNRNPA1 | heterogeneous nuclear ribonucleoprotein A1 | 9823 | OMA, EggNOG | |
| Xenopus | 496507 | hnrnpa1 | heterogeneous nuclear ribonucleoprotein A1 | 8364 | XB-GENE-493963 | OMA, EggNOG |
| C. elegans | 177101 | hrp-1 | Heterogeneous nuclear ribonucleoprotein A1 | 6239 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.