🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

MRPS18B

Beschreibung28S ribosomal protein S18b, mitochondrial

Gene and Protein Information

Gene ID28973
Uniprot Accession IDs Q9Y676 A6NDQ0 Q659G4 Q9BS27 MRP-S18-b
Ensembl ID ENSP00000259873
Symbol C6orf14 PTD017 S18amt C6orf14 HSPC183 MRPS18-2 HumanS18a MRP-S18-2
FamilyBelongs to the bacterial ribosomal protein bS18 family. Mitochondrion-specific ribosomal protein mS40 subfamily.
Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp462545MRPS18Bmitochondrial ribosomal protein S18B9598VGNC:11126Inparanoid, OMA
Macaque713694MRPS18Bmitochondrial ribosomal protein S18B9544Inparanoid, OMA
Mouse66973Mrps18bmitochondrial ribosomal protein S18B10090MGI:1914223Inparanoid, OMA
Rat294230Mrps18bmitochondrial ribosomal protein S18B10116RGD:1302998Inparanoid, OMA
Dog474827MRPS18Bmitochondrial ribosomal protein S18B9615VGNC:43413Inparanoid, OMA
Horse100051230MRPS18Bmitochondrial ribosomal protein S18B9796VGNC:20358Inparanoid, OMA
Cow510824MRPS18Bmitochondrial ribosomal protein S18B9913VGNC:50008Inparanoid, OMA
Pig100144465MRPS18Bmitochondrial ribosomal protein S18B9823Inparanoid, OMA
Opossum100024187MRPS18Bmitochondrial ribosomal protein S18B13616Inparanoid, OMA
Anole lizard100561161mrps18bmitochondrial ribosomal protein S18B28377Inparanoid, OMA
Zebrafish550455mrps18bmitochondrial ribosomal protein S18B7955ZDB-GENE-050417-278Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.