GJC3

BeschreibungGap junction gamma-3 protein

Gene and Protein Information

Gene ID349149
Uniprot Accession IDs Q8NFK1 A4D296 Q86XI9
Ensembl ID ENSP00000325775
Symbol GJE1 CX29 GJE1 CX30.2 CX31.3
FamilyBelongs to the connexin family. Gamma-type subfamily.
Sequence
MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp737656GJC3gap junction protein gamma 39598VGNC:14017OMA, EggNOG
Macaque100424576LOC100424576gap junction gamma-3 protein9544OMA, EggNOG
Mouse118446Gjc3gap junction protein, gamma 310090MGI:2153041Inparanoid, OMA, EggNOG
Rat288529Gjc3gap junction protein, gamma 310116RGD:727930Inparanoid, OMA, EggNOG
Dog489850GJC3gap junction protein gamma 39615VGNC:54027Inparanoid, OMA, EggNOG
Horse100068490GJC3gap junction protein gamma 39796VGNC:18361Inparanoid, OMA, EggNOG
Cow539991GJC3gap junction protein gamma 39913VGNC:29384Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction gamma-3 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction gamma-3 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.