🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

SPR

BeschreibungSepiapterin reductase

Gene and Protein Information

Gene ID6697
Uniprot Accession IDs P35270 A8K741 D6W5H2 Q53GI9 Q9UBB1 SPR
Ensembl ID ENSP00000234454
Symbol SDR38C1
FamilyBelongs to the sepiapterin reductase family.
Sequence
MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque705317SPRsepiapterin reductase9544Inparanoid, OMA, EggNOG
Mouse20751Sprsepiapterin reductase10090MGI:103078Inparanoid, OMA, EggNOG
Rat29270Sprsepiapterin reductase10116RGD:3753Inparanoid, OMA, EggNOG
Dog483118SPRsepiapterin reductase9615VGNC:49109Inparanoid, OMA, EggNOG
Cow533836SPRsepiapterin reductase9913Inparanoid, OMA, EggNOG
Pig100521367SPRsepiapterin reductase9823OMA, EggNOG
Chicken425255SPRsepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)9031CGNC:32Inparanoid, OMA, EggNOG
Anole lizardSPRsepiapterin reductase [Source:HGNC Symbol;Acc:HGNC:11257]28377Inparanoid, OMA, EggNOG
Zebrafish554136sprasepiapterin reductase a7955ZDB-GENE-050522-412OMA, EggNOG
Zebrafish795445sprbsepiapterin reductase b7955ZDB-GENE-070719-1Inparanoid, OMA
Fruitfly31781SptrSepiapterin reductase7227FBgn0014032Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.