Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Somatostatin receptor type 2 |
|---|
Gene and Protein Information
| Gene ID | 6752 |
|---|---|
| Uniprot Accession IDs | P30874 A8K3Y0 B2R9P7 Q4VBP0 Q96GE0 Q96TF2 Q9BWH1 SS-2-R |
| Ensembl ID | ENSP00000350198 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 695526 | SSTR2 | somatostatin receptor 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20606 | Sstr2 | somatostatin receptor 2 | 10090 | MGI:98328 | Inparanoid, OMA, EggNOG |
| Rat | 54305 | Sstr2 | somatostatin receptor 2 | 10116 | RGD:3763 | Inparanoid, OMA, EggNOG |
| Dog | 403472 | SSTR2 | somatostatin receptor 2 | 9615 | VGNC:46844 | Inparanoid, OMA, EggNOG |
| Horse | 100052744 | SSTR2 | somatostatin receptor 2 | 9796 | VGNC:23621 | Inparanoid, OMA, EggNOG |
| Cow | 282083 | SSTR2 | somatostatin receptor 2 | 9913 | VGNC:35326 | Inparanoid, OMA, EggNOG |
| Pig | SSTR2 | somatostatin receptor 2 [Source:HGNC Symbol;Acc:HGNC:11331] | 9823 | Inparanoid, OMA, EggNOG | ||
| Opossum | 100028527 | SSTR2 | somatostatin receptor 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100090283 | SSTR2 | somatostatin receptor 2 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100563000 | sstr2 | somatostatin receptor 2 | 28377 | Inparanoid, OMA | |
| Xenopus | 100496382 | sstr2 | somatostatin receptor 2 | 8364 | XB-GENE-953419 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Somatostatin receptor type 2
protein / G-protein coupled receptor / Class A rhodopsin like / Somatostatin receptor type 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.