🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

SUCNR1

BeschreibungSuccinate receptor 1

Gene and Protein Information

Gene ID56670
Uniprot Accession IDs Q9BXA5 A8K305 Q8TDQ8
Ensembl ID ENSP00000355156
Symbol GPR91 GPR91
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp738824SUCNR1succinate receptor 19598VGNC:12200OMA, EggNOG
Mouse84112Sucnr1succinate receptor 110090MGI:1934135Inparanoid, OMA, EggNOG
Rat408199Sucnr1succinate receptor 110116RGD:1303193Inparanoid, OMA, EggNOG
Dog485719SUCNR1succinate receptor 19615VGNC:46968Inparanoid, OMA, EggNOG
Horse100056372SUCNR1succinate receptor 19796VGNC:23745Inparanoid, OMA, EggNOG
Cow539622SUCNR1succinate receptor 19913VGNC:35458OMA, EggNOG
Pig100739158SUCNR1succinate receptor 19823OMA, EggNOG
Platypus100083905SUCNR1succinate receptor 19258OMA, EggNOG
Chicken771768SUCNR1succinate receptor 19031CGNC:7886Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Succinate receptor 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.