🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

TXNDC12

BeschreibungThioredoxin domain-containing protein 12

Gene and Protein Information

Gene ID51060
Uniprot Accession IDs O95881 B3KQS0 Q5T1T4 Q96H50
Ensembl ID ENSP00000360688
Symbol TLP19 AG1 AGR1 ERP16 ERP18 ERP19 TLP19 hAG-1 PDIA16 hTLP19
Sequence
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp100610643TXNDC12thioredoxin domain containing 129598VGNC:9409OMA, EggNOG
Mouse66073Txndc12thioredoxin domain containing 12 (endoplasmic reticulum)10090MGI:1913323Inparanoid, OMA, EggNOG
Rat298370Txndc12thioredoxin domain containing 1210116RGD:1305960Inparanoid, OMA, EggNOG
Dog609843TXNDC12thioredoxin domain containing 129615VGNC:48011Inparanoid, OMA, EggNOG
Horse100062254TXNDC12thioredoxin domain containing 129796VGNC:24677Inparanoid, OMA, EggNOG
Cow506991TXNDC12thioredoxin domain containing 129913VGNC:36535Inparanoid, OMA, EggNOG
Pig100517534TXNDC12thioredoxin domain containing 129823OMA, EggNOG
Opossum103095270TXNDC12thioredoxin domain containing 1213616Inparanoid, OMA, EggNOG
Chicken772208TXNDC12thioredoxin domain containing 129031CGNC:8025Inparanoid, OMA, EggNOG
Anole lizard100562080txndc12thioredoxin domain containing 1228377Inparanoid, OMA, EggNOG
Zebrafish324900txndc12thioredoxin domain containing 12 (endoplasmic reticulum)7955ZDB-GENE-050522-497Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    reductase    /    Thioredoxin domain-containing protein 12
protein    /    oxidoreductase    /    surfactant    /    Thioredoxin domain-containing protein 12
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Reductase    /    Thioredoxin domain-containing protein 12

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.