🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

VAMP3

BeschreibungVesicle-associated membrane protein 3

Gene and Protein Information

Gene ID9341
Uniprot Accession IDs Q15836 Q9BRV4 VAMP-3
Ensembl ID ENSP00000054666
Symbol SYB3 CEB
FamilyBelongs to the synaptobrevin family.
Sequence
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp457906VAMP3vesicle associated membrane protein 39598VGNC:7022Inparanoid, OMA, EggNOG
Macaque707972VAMP3vesicle associated membrane protein 39544Inparanoid, EggNOG
Mouse22319Vamp3vesicle-associated membrane protein 310090MGI:1321389Inparanoid, OMA, EggNOG
Rat29528Vamp3vesicle-associated membrane protein 310116RGD:61880Inparanoid, OMA, EggNOG
Dog102154970VAMP3vesicle associated membrane protein 39615VGNC:48223Inparanoid, OMA, EggNOG
Horse100630321VAMP3vesicle associated membrane protein 39796VGNC:50791Inparanoid, OMA, EggNOG
Cow505379VAMP3vesicle associated membrane protein 39913VGNC:36757Inparanoid, OMA, EggNOG
Chicken419368VAMP3vesicle-associated membrane protein 39031CGNC:359Inparanoid, OMA, EggNOG
Anole lizard100552036vamp3vesicle associated membrane protein 328377Inparanoid, EggNOG
Xenopusvamp3vesicle associated membrane protein 3 [Source:Xenbase;Acc:XB-GENE-1014996]8364OMA, EggNOG
Zebrafish415163vamp3vesicle-associated membrane protein 3 (cellubrevin)7955ZDB-GENE-040625-45Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.