Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | TYRO protein tyrosine kinase-binding protein |
|---|
Gene and Protein Information
| Gene ID | 7305 |
|---|---|
| Uniprot Accession IDs | O43914 A8K2X0 F5H389 Q6FGA5 Q9UMT3 |
| Ensembl ID | ENSP00000262629 |
| Symbol | DAP12 KARAP DAP12 KARAP PLOSL PLOSL1 |
| Family | Belongs to the TYROBP family. |
| Sequence | MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455968 | TYROBP | TYRO protein tyrosine kinase binding protein | 9598 | VGNC:2209 | Inparanoid, OMA, EggNOG |
| Macaque | 574207 | TYROBP | TYRO protein tyrosine kinase binding protein | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22177 | Tyrobp | TYRO protein tyrosine kinase binding protein | 10090 | MGI:1277211 | Inparanoid, OMA, EggNOG |
| Rat | 361537 | Tyrobp | Tyro protein tyrosine kinase binding protein | 10116 | RGD:1303081 | Inparanoid, OMA, EggNOG |
| Dog | 476477 | TYROBP | TYRO protein tyrosine kinase binding protein | 9615 | VGNC:48028 | Inparanoid, OMA, EggNOG |
| Horse | 100051740 | TYROBP | TYRO protein tyrosine kinase binding protein | 9796 | VGNC:24692 | Inparanoid, OMA, EggNOG |
| Cow | 282390 | TYROBP | TYRO protein tyrosine kinase binding protein | 9913 | VGNC:36552 | Inparanoid, OMA, EggNOG |
| Pig | 397405 | TYROBP | TYRO protein tyrosine kinase binding protein | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | TYROBP | TYRO protein tyrosine kinase binding protein [Source:HGNC Symbol;Acc:HGNC:12449] | 13616 | Inparanoid, EggNOG | ||
| Zebrafish | 100101461 | tyrobp | TYRO protein tyrosine kinase binding protein | 7955 | ZDB-GENE-061130-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.