CYP27A1

BeschreibungSterol 26-hydroxylase, mitochondrial

Gene and Protein Information

Gene ID1593
Uniprot Accession IDs Q02318 A8K303 Q6LDB4 Q86YQ6
Ensembl ID ENSP00000258415
Symbol CYP27 CTX CP27 CYP27
FamilyBelongs to the cytochrome P450 family.
Sequence
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp459951LOC459951sterol 26-hydroxylase, mitochondrial9598OMA, EggNOG
Macaque700192CYP27A1cytochrome P450, family 27, subfamily A, polypeptide 19544Inparanoid, OMA, EggNOG
Mouse104086Cyp27a1cytochrome P450, family 27, subfamily a, polypeptide 110090MGI:88594Inparanoid, OMA, EggNOG
Rat301517Cyp27a1cytochrome P450, family 27, subfamily a, polypeptide 110116RGD:727915Inparanoid, OMA, EggNOG
Dog610489CYP27A1cytochrome P450 family 27 subfamily A member 19615VGNC:50342Inparanoid, OMA, EggNOG
Horse100055936CYP27A1cytochrome P450 family 27 subfamily A member 19796VGNC:50564Inparanoid, OMA, EggNOG
Cow511960CYP27A1cytochrome P450, family 27, subfamily A, polypeptide 19913Inparanoid, OMA, EggNOG
Pig100126282CYP27A1cytochrome P450, family 27, subfamily A, polypeptide 19823Inparanoid, EggNOG
Opossum100011045CYP27A1sterol 27-hydroxylase13616Inparanoid, OMA, EggNOG
Chicken431683CYP27A1cytochrome P450 family 27 subfamily A member 19031CGNC:1767Inparanoid, OMA, EggNOG
Anole lizard100565025LOC100565025sterol 26-hydroxylase, mitochondrial28377OMA, EggNOG
Xenopus100145331LOC100145331sterol 26-hydroxylase, mitochondrial8364XB-GENE-984298OMA, EggNOG
Xenopus100145773cyp27a1cytochrome P450 family 27 subfamily A member 18364XB-GENE-5871552Inparanoid, OMA
Zebrafish402831cyp27a7cytochrome P450, family 27, subfamily A, polypeptide 77955ZDB-GENE-081104-519Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxygenase    /    Sterol 26-hydroxylase, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxygenase    /    Sterol 26-hydroxylase, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.