🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Serine/threonine-protein kinase ICK |
|---|
Gene and Protein Information
| Gene ID | 22858 |
|---|---|
| Uniprot Accession IDs | Q9UPZ9 A7MD41 O75985 Q5THL2 Q8IYH8 Q9BX17 Q9NYX3 |
| Ensembl ID | ENSP00000349458 |
| Symbol | KIAA0936 ECO MRK LCK2 EJM10 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462772 | ICK | intestinal cell kinase | 9598 | VGNC:12641 | OMA, EggNOG |
| Macaque | 711865 | ICK | intestinal cell kinase | 9544 | OMA, EggNOG | |
| Mouse | 56542 | Ick | intestinal cell kinase | 10090 | MGI:1934157 | Inparanoid, OMA, EggNOG |
| Rat | 84411 | Ick | intestinal cell kinase | 10116 | RGD:71050 | Inparanoid, OMA, EggNOG |
| Dog | 481843 | ICK | intestinal cell kinase | 9615 | VGNC:41860 | Inparanoid, OMA |
| Horse | 100056645 | ICK | intestinal cell kinase | 9796 | VGNC:18931 | Inparanoid, OMA, EggNOG |
| Cow | 506286 | ICK | intestinal cell kinase | 9913 | VGNC:30028 | Inparanoid, OMA |
| Pig | 100511822 | ICK | intestinal cell kinase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100014080 | ICK | intestinal cell kinase | 13616 | Inparanoid, OMA | |
| Chicken | 421896 | ICK | intestinal cell kinase | 9031 | CGNC:12208 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552302 | ick | intestinal cell kinase | 28377 | Inparanoid, OMA, EggNOG | |
| C. elegans | 187442 | dyf-5 | Serine/threonine-protein kinase dyf-5 | 6239 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.