🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | ICOS ligand |
|---|
Gene and Protein Information
| Gene ID | 102723996 |
|---|---|
| Uniprot Accession IDs | O75144 A8MUZ1 Q9HD18 Q9NRQ1 |
| Ensembl ID | ENSP00000483732 |
| Symbol | B7H2 B7RP1 ICOSL KIAA0653 |
| Family | Belongs to the immunoglobulin superfamily. BTN/MOG family. |
| Sequence | MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 474132 | ICOSLG | inducible T-cell costimulator ligand | 9598 | OMA, EggNOG | |
| Macaque | 722191 | ICOSLG | inducible T-cell costimulator ligand | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 50723 | Icosl | icos ligand | 10090 | MGI:1354701 | Inparanoid, EggNOG |
| Rat | 499415 | Icoslg | inducible T-cell co-stimulator ligand | 10116 | RGD:1562791 | Inparanoid, EggNOG |
| Dog | 487793 | ICOSLG | inducible T-cell costimulator ligand | 9615 | Inparanoid, EggNOG | |
| Cow | 507857 | ICOSLG | inducible T-cell costimulator ligand | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100621467 | ICOSLG | inducible T-cell costimulator ligand | 9823 | OMA, EggNOG | |
| Anole lizard | 103278357 | icoslg | inducible T-cell costimulator ligand | 28377 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.