🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

ID3

BeschreibungDNA-binding protein inhibitor ID-3

Gene and Protein Information

Gene ID3399
Uniprot Accession IDs Q02535 A8K1T8 O75641
Ensembl ID ENSP00000363689
Symbol 1R21 BHLHB25 HEIR1 HEIR-1 bHLHb25
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp745532ID3inhibitor of DNA binding 3, HLH protein9598VGNC:8347OMA, EggNOG
Mouse15903Id3inhibitor of DNA binding 310090MGI:96398Inparanoid, OMA, EggNOG
Rat25585Id3inhibitor of DNA binding 3, HLH protein10116RGD:2860Inparanoid, OMA, EggNOG
Dog403547ID3inhibitor of DNA binding 3, HLH protein9615VGNC:41862Inparanoid, OMA, EggNOG
Horse100071592ID3inhibitor of DNA binding 3, HLH protein9796VGNC:18935Inparanoid, OMA, EggNOG
Cow538690ID3inhibitor of DNA binding 3, HLH protein9913VGNC:30032Inparanoid, OMA, EggNOG
Opossum100009765ID3inhibitor of DNA binding 3, HLH protein13616Inparanoid, OMA, EggNOG
Platypus100083679ID3inhibitor of DNA binding 3, HLH protein9258Inparanoid, OMA, EggNOG
Xenopus549025id3inhibitor of DNA binding 3, HLH protein8364XB-GENE-495261Inparanoid, OMA, EggNOG
Zebrafish246093id3inhibitor of DNA binding 37955ZDB-GENE-020515-1OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.