Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Insulin-like growth factor I |
|---|
Gene and Protein Information
| Gene ID | 3479 |
|---|---|
| Uniprot Accession IDs | P05019 B2RWM7 E9PD02 P01343 Q14620 IGF-I |
| Ensembl ID | ENSP00000302665 |
| Symbol | IBP1 IGF MGF IGFI IGF-I |
| Family | Belongs to the insulin family. |
| Sequence | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741055 | IGF1 | insulin like growth factor 1 | 9598 | VGNC:5427 | OMA, EggNOG |
| Macaque | 698444 | IGF1 | insulin like growth factor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16000 | Igf1 | insulin-like growth factor 1 | 10090 | MGI:96432 | Inparanoid, OMA, EggNOG |
| Rat | 24482 | Igf1 | insulin-like growth factor 1 | 10116 | RGD:2868 | Inparanoid, OMA, EggNOG |
| Dog | 610255 | IGF1 | insulin like growth factor 1 | 9615 | VGNC:41895 | Inparanoid, OMA, EggNOG |
| Horse | 100034198 | IGF1 | insulin like growth factor 1 | 9796 | VGNC:18967 | Inparanoid, OMA, EggNOG |
| Cow | 281239 | IGF1 | insulin like growth factor 1 | 9913 | VGNC:30076 | Inparanoid, OMA, EggNOG |
| Pig | 397491 | IGF1 | insulin like growth factor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100021295 | IGF1 | insulin like growth factor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100075905 | IGF1 | insulin like growth factor 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 418090 | IGF1 | insulin like growth factor 1 | 9031 | CGNC:9671 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566682 | igf1 | insulin like growth factor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100486334 | igf1 | insulin like growth factor 1 | 8364 | XB-GENE-480239 | Inparanoid, OMA, EggNOG |
| Zebrafish | 114433 | igf1 | insulin-like growth factor 1 | 7955 | ZDB-GENE-010607-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.