🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

FOS

BeschreibungProto-oncogene c-Fos

Gene and Protein Information

Gene ID2353
Uniprot Accession IDs P01100 A8K4E2 B4DQ65 P18849
Ensembl ID ENSP00000306245
Symbol G0S7 p55 AP-1 C-FOS
FamilyBelongs to the bZIP family. Fos subfamily.
Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Mouse14281FosFBJ osteosarcoma oncogene10090MGI:95574Inparanoid, OMA, EggNOG
Rat314322FosFos proto-oncogene, AP-1 transcription factor subunit10116RGD:2626Inparanoid, OMA, EggNOG
Dog490792FOSFos proto-oncogene, AP-1 transcription factor subunit9615VGNC:40940Inparanoid, OMA, EggNOG
Horse100051632FOSFos proto-oncogene, AP-1 transcription factor subunit9796VGNC:18095Inparanoid, OMA, EggNOG
Cow280795FOSFos proto-oncogene, AP-1 transcription factor subunit9913VGNC:29073Inparanoid, OMA, EggNOG
Pig100144486FOSFos proto-oncogene, AP-1 transcription factor subunit9823Inparanoid, OMA, EggNOG
Opossum100018285FOSFos proto-oncogene, AP-1 transcription factor subunit13616Inparanoid, EggNOG
Platypus100075021FOSFos proto-oncogene, AP-1 transcription factor subunit9258Inparanoid, OMA, EggNOG
Chicken396512FOSFos proto-oncogene, AP-1 transcription factor subunit9031CGNC:49845Inparanoid, OMA
Anole lizard100556427fosFos proto-oncogene, AP-1 transcription factor subunit28377Inparanoid, OMA, EggNOG
Xenopus548954fosFBJ murine osteosarcoma viral oncogene homolog8364XB-GENE-866811Inparanoid, OMA, EggNOG
Zebrafish394198fosabv-fos FBJ murine osteosarcoma viral oncogene homolog Ab7955ZDB-GENE-031222-4OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.