Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Fibroblast growth factor 23 |
|---|
Gene and Protein Information
| Gene ID | 8074 |
|---|---|
| Uniprot Accession IDs | Q9GZV9 Q4V758 FGF-23 |
| Ensembl ID | ENSP00000237837 |
| Symbol | HYPF ADHR FGFN HYPF HFTC2 HPDR2 PHPTC |
| Family | Belongs to the heparin-binding growth factors family. |
| Sequence | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 747164 | FGF23 | fibroblast growth factor 23 | 9598 | VGNC:5380 | OMA, EggNOG |
| Mouse | 64654 | Fgf23 | fibroblast growth factor 23 | 10090 | MGI:1891427 | Inparanoid, OMA, EggNOG |
| Rat | 170583 | Fgf23 | fibroblast growth factor 23 | 10116 | RGD:620178 | Inparanoid, OMA |
| Dog | 611773 | FGF23 | fibroblast growth factor 23 | 9615 | VGNC:54303 | OMA, EggNOG |
| Horse | 100058460 | FGF23 | fibroblast growth factor 23 | 9796 | VGNC:18017 | Inparanoid, OMA, EggNOG |
| Cow | 530239 | FGF23 | fibroblast growth factor 23 | 9913 | VGNC:28978 | Inparanoid, OMA, EggNOG |
| Opossum | FGF23 | fibroblast growth factor 23 [Source:HGNC Symbol;Acc:HGNC:3680] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 428104 | FGF23 | fibroblast growth factor 23 | 9031 | CGNC:66548 | Inparanoid, OMA |
| Anole lizard | 100559987 | fgf23 | fibroblast growth factor 23 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100496800 | fgf23.2 | fibroblast growth factor 23, gene 2 | 8364 | XB-GENE-482986 | Inparanoid, OMA, EggNOG |
| Zebrafish | 494456 | fgf23 | fibroblast growth factor 23 | 7955 | ZDB-GENE-050201-4 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.