🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Fatty acid-binding protein, heart |
|---|
Gene and Protein Information
| Gene ID | 2170 |
|---|---|
| Uniprot Accession IDs | P05413 B2RAB6 Q5VV93 Q99957 |
| Ensembl ID | ENSP00000362817 |
| Symbol | FABP11 MDGI MDGI FABP11 H-FABP M-FABP O-FABP |
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Sequence | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456699 | FABP3 | fatty acid binding protein 3 | 9598 | VGNC:6801 | OMA, EggNOG |
| Mouse | 14074 | Fabp3-ps1 | fatty acid binding protein 3, muscle and heart, pseudogene 1 | 10090 | MGI:101929 | Inparanoid, OMA |
| Rat | 79131 | Fabp3 | fatty acid binding protein 3 | 10116 | RGD:69048 | Inparanoid, OMA, EggNOG |
| Dog | 478156 | FABP3 | fatty acid binding protein 3 | 9615 | VGNC:40561 | Inparanoid, OMA, EggNOG |
| Horse | 100033895 | FABP3 | fatty acid binding protein 3 | 9796 | VGNC:17768 | Inparanoid, OMA, EggNOG |
| Cow | 281758 | FABP3 | fatty acid binding protein 3 | 9913 | VGNC:28697 | Inparanoid, OMA, EggNOG |
| Opossum | FABP3 | fatty acid binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3557] | 13616 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 548540 | fabp3 | fatty acid binding protein 3 | 8364 | XB-GENE-974423 | OMA, EggNOG |
| Zebrafish | 171478 | fabp3 | fatty acid binding protein 3, muscle and heart | 7955 | ZDB-GENE-020318-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.