🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

FGF17

BeschreibungFibroblast growth factor 17

Gene and Protein Information

Gene ID8822
Uniprot Accession IDs O60258 B7ZLG4 Q2M2W1 FGF-17
Ensembl ID ENSP00000352414
Symbol HH20 FGF-13 FGF-17
FamilyBelongs to the heparin-binding growth factors family.
Sequence
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp472708FGF17fibroblast growth factor 179598VGNC:12011OMA, EggNOG
Mouse14171Fgf17fibroblast growth factor 1710090MGI:1202401Inparanoid, OMA, EggNOG
Rat29368Fgf17fibroblast growth factor 1710116RGD:2607Inparanoid, OMA, EggNOG
Dog607952FGF17fibroblast growth factor 179615VGNC:40844Inparanoid, OMA, EggNOG
Horse100056444FGF17fibroblast growth factor 179796VGNC:18014Inparanoid, OMA, EggNOG
CowFGF17fibroblast growth factor 17 [Source:HGNC Symbol;Acc:HGNC:3673]9913OMA, EggNOG
Pig100155720FGF17fibroblast growth factor 179823OMA, EggNOG
Opossum100030474FGF17fibroblast growth factor 1713616Inparanoid, EggNOG
Platypus100088500FGF17fibroblast growth factor 179258Inparanoid, OMA, EggNOG
Zebrafish407737fgf17fibroblast growth factor 177955ZDB-GENE-040621-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Fibroblast growth factor 17
DTO Classes
protein    /    Signaling    /    Growth factor    /    Fibroblast growth factor 17

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.