Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Histone acetyltransferase type B catalytic subunit |
|---|
Gene and Protein Information
| Gene ID | 8520 |
|---|---|
| Uniprot Accession IDs | O14929 Q49A44 Q53QF0 Q53SU4 Q6P594 Q8WWB9 |
| Ensembl ID | ENSP00000264108 |
| Symbol | KAT1 KAT1 |
| Family | Belongs to the HAT1 family. |
| Sequence | MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459737 | HAT1 | histone acetyltransferase 1 | 9598 | VGNC:1956 | OMA, EggNOG |
| Macaque | 695933 | HAT1 | histone acetyltransferase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 107435 | Hat1 | histone aminotransferase 1 | 10090 | MGI:96013 | Inparanoid, OMA, EggNOG |
| Rat | 296501 | Hat1 | histone acetyltransferase 1 | 10116 | RGD:1305716 | Inparanoid, OMA, EggNOG |
| Dog | 478799 | HAT1 | histone acetyltransferase 1 | 9615 | VGNC:50624 | Inparanoid, OMA, EggNOG |
| Horse | 100063802 | HAT1 | histone acetyltransferase 1 | 9796 | VGNC:50591 | Inparanoid, OMA, EggNOG |
| Cow | 509329 | HAT1 | histone acetyltransferase 1 | 9913 | VGNC:49063 | Inparanoid, OMA, EggNOG |
| Pig | 100622317 | HAT1 | histone acetyltransferase 1 | 9823 | OMA, EggNOG | |
| Opossum | 100025069 | HAT1 | histone acetyltransferase 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | HAT1 | histone acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4821] | 9258 | OMA, EggNOG | ||
| Chicken | 374037 | HAT1 | histone acetyltransferase 1 | 9031 | CGNC:7250 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100554251 | hat1 | histone acetyltransferase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100145138 | hat1 | histone acetyltransferase 1 | 8364 | XB-GENE-952148 | Inparanoid, OMA, EggNOG |
| Zebrafish | 447833 | hat1 | histone acetyltransferase 1 | 7955 | ZDB-GENE-040912-99 | Inparanoid, OMA, EggNOG |
| C. elegans | 176458 | hat-1 | Histone AcetylTransferase | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 856106 | HAT1 | histone acetyltransferase catalytic subunit HAT1 | 4932 | S000005922 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transferase / acetyltransferase / Histone acetyltransferase type B catalytic subunit
protein / transferase / acetyltransferase / Histone acetyltransferase type B catalytic subunit
DTO Classes
protein / Enzyme / Transferase / Acetyltransferase / Histone acetyltransferase type B catalytic subunit
protein / Enzyme / Transferase / Acetyltransferase / Histone acetyltransferase type B catalytic subunit
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.