Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | KiSS-1 receptor |
|---|
Gene and Protein Information
| Gene ID | 84634 |
|---|---|
| Uniprot Accession IDs | Q969F8 A5D8U2 B2RTV1 Q96QG0 KiSS-1R |
| Ensembl ID | ENSP00000234371 |
| Symbol | AXOR12 GPR54 HH8 CPPB1 GPR54 AXOR12 KISS-1R HOT7T175 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741289 | KISS1R | KISS1 receptor | 9598 | VGNC:2333 | OMA, EggNOG |
| Macaque | 574305 | KISS1R | KISS1 receptor | 9544 | OMA, EggNOG | |
| Mouse | 114229 | Kiss1r | KISS1 receptor | 10090 | MGI:2148793 | Inparanoid, OMA, EggNOG |
| Rat | 78976 | Kiss1r | KISS1 receptor | 10116 | RGD:70930 | Inparanoid, OMA, EggNOG |
| Dog | 612374 | KISS1R | KISS1 receptor | 9615 | VGNC:42421 | Inparanoid, OMA, EggNOG |
| Cow | 528699 | KISS1R | KISS1 receptor | 9913 | VGNC:30617 | OMA, EggNOG |
| Pig | 733704 | KISS1R | KISS1 receptor | 9823 | OMA, EggNOG | |
| Platypus | KISS1R | KISS1 receptor [Source:HGNC Symbol;Acc:HGNC:4510] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100567120 | LOC100567120 | G-protein coupled receptor 54 | 28377 | OMA, EggNOG | |
| Xenopus | 100316929 | kiss1r | KISS1 receptor | 8364 | XB-GENE-990075 | OMA, EggNOG |
| Zebrafish | 100002715 | kiss1rb | KISS1 receptor b | 7955 | ZDB-GENE-060526-54 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Kisspeptin receptor / Kiss-1 receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Kisspeptin receptor / Kiss-1 receptor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.