Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | RNA-binding protein FUS |
|---|
Gene and Protein Information
| Gene ID | 2521 |
|---|---|
| Uniprot Accession IDs | P35637 Q9H4A8 |
| Ensembl ID | ENSP00000254108 |
| Symbol | TLS TLS ALS6 ETM4 FUS1 POMP75 HNRNPP2 |
| Family | Belongs to the RRM TET family. |
| Sequence | MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 233908 | Fus | fused in sarcoma | 10090 | MGI:1353633 | Inparanoid, OMA |
| Rat | 317385 | Fus | FUS RNA binding protein | 10116 | RGD:1308864 | Inparanoid, OMA |
| Dog | 100856381 | FUS | FUS RNA binding protein | 9615 | VGNC:41011 | Inparanoid, OMA |
| Cow | 280796 | FUS | FUS RNA binding protein | 9913 | VGNC:29147 | Inparanoid, OMA |
| Pig | 100522185 | FUS | FUS RNA binding protein | 9823 | Inparanoid, OMA | |
| Opossum | 100013799 | FUS | FUS RNA binding protein | 13616 | Inparanoid, OMA | |
| Anole lizard | 100556650 | fus | FUS RNA binding protein | 28377 | Inparanoid, OMA | |
| Xenopus | 100038234 | fus | FUS RNA binding protein | 8364 | XB-GENE-495119 | Inparanoid, OMA |
| Zebrafish | 394058 | fus | FUS RNA binding protein | 7955 | ZDB-GENE-040426-1010 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / RNA-binding protein FUS
protein / nucleic acid binding / transcription factor / RNA-binding protein FUS
protein / nucleic acid binding / mRNA splicing factor / RNA-binding protein FUS
protein / nucleic acid binding / DNA binding protein / RNA-binding protein FUS
protein / nucleic acid binding / transcription factor / RNA-binding protein FUS
protein / nucleic acid binding / mRNA splicing factor / RNA-binding protein FUS
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / RNA-binding protein FUS
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / RNA-binding protein FUS
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.