FZD6

BeschreibungFrizzled-6

Gene and Protein Information

Gene ID8323
Uniprot Accession IDs O60353 B4DRN0 Q6N0A5 Q6P9C3 Q8WXR9 Fz-6
Ensembl ID ENSP00000351605
Symbol FZ6 FZ-6 HFZ6 NDNC10
FamilyBelongs to the G-protein coupled receptor Fz/Smo family.
Sequence
MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp464327FZD6frizzled class receptor 69598VGNC:869OMA, EggNOG
Macaque694625FZD6frizzled class receptor 69544Inparanoid, OMA, EggNOG
Mouse14368Fzd6frizzled class receptor 610090MGI:108474Inparanoid, OMA, EggNOG
Rat282581Fzd6frizzled class receptor 610116RGD:628816Inparanoid, OMA, EggNOG
Dog403610FZD6frizzled class receptor 69615VGNC:41034Inparanoid, OMA, EggNOG
Horse100056351FZD6frizzled class receptor 69796VGNC:18174Inparanoid, OMA, EggNOG
Cow445418FZD6frizzled class receptor 69913VGNC:29170Inparanoid, OMA, EggNOG
Pig100157360FZD6frizzled class receptor 69823OMA, EggNOG
Opossum100023959FZD6frizzled class receptor 613616Inparanoid, OMA, EggNOG
PlatypusFZD6frizzled class receptor 6 [Source:HGNC Symbol;Acc:HGNC:4044]9258OMA, EggNOG
Anole lizard100565631fzd6frizzled class receptor 628377Inparanoid, OMA
Xenopus100490861fzd6frizzled class receptor 68364XB-GENE-478813Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    protease inhibitor    /    Frizzled-6
protein    /    receptor    /    signaling molecule    /    Frizzled-6
protein    /    receptor    /    G-protein coupled receptor    /    Frizzled-6
DTO Classes
protein    /    G-protein coupled receptor    /    Class F frizzled-type    /    Frizzled receptor    /    Frizzled-6

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.