Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Flotillin-2 |
|---|
Gene and Protein Information
| Gene ID | 2319 |
|---|---|
| Uniprot Accession IDs | Q14254 |
| Ensembl ID | ENSP00000378368 |
| Symbol | ESA1 M17S1 ESA ECS1 ESA1 ECS-1 M17S1 |
| Family | Belongs to the band 7/mec-2 family. Flotillin subfamily. |
| Sequence | MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454537 | FLOT2 | flotillin 2 | 9598 | VGNC:9433 | OMA, EggNOG |
| Macaque | 716527 | FLOT2 | flotillin 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14252 | Flot2 | flotillin 2 | 10090 | MGI:103309 | Inparanoid, OMA, EggNOG |
| Rat | 83764 | Flot2 | flotillin 2 | 10116 | RGD:70993 | Inparanoid, OMA |
| Horse | 100072090 | FLOT2 | flotillin 2 | 9796 | VGNC:18064 | Inparanoid, OMA, EggNOG |
| Cow | 615679 | FLOT2 | flotillin 2 | 9913 | VGNC:29037 | Inparanoid, OMA, EggNOG |
| Pig | 100518752 | FLOT2 | flotillin 2 | 9823 | OMA, EggNOG | |
| Opossum | 100025079 | FLOT2 | flotillin 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100563055 | flot2 | flotillin 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496443 | flot2 | flotillin 2 | 8364 | XB-GENE-5910825 | Inparanoid, OMA, EggNOG |
| Zebrafish | 245698 | flot2a | flotillin 2a | 7955 | ZDB-GENE-020430-3 | Inparanoid, OMA |
| Zebrafish | 393612 | flot2b | flotillin 2b | 7955 | ZDB-GENE-040426-1368 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.