🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

FCGRT

BeschreibungIgG receptor FcRn large subunit p51

Gene and Protein Information

Gene ID2217
Uniprot Accession IDs P55899 Q5HYM5 Q9HBV7 Q9NZ19 FcRn
Ensembl ID ENSP00000221466
Symbol FCRN FCRN alpha-chain
FamilyBelongs to the immunoglobulin superfamily.
Sequence
MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp456208FCGRTFc fragment of IgG receptor and transporter9598VGNC:7558Inparanoid, OMA, EggNOG
Macaque718859FCGRTFc fragment of IgG receptor and transporter9544Inparanoid, OMA, EggNOG
Mouse14132FcgrtFc receptor, IgG, alpha chain transporter10090MGI:103017Inparanoid, OMA, EggNOG
Rat29558FcgrtFc fragment of IgG receptor and transporter10116RGD:61811Inparanoid, OMA, EggNOG
Dog476414FCGRTFc fragment of IgG receptor and transporter9615VGNC:40803Inparanoid, OMA, EggNOG
Horse100147583FCGRTFc fragment of IgG receptor and transporter9796VGNC:17976Inparanoid, OMA, EggNOG
Cow338062FCGRTFc fragment of IgG receptor and transporter9913VGNC:28934Inparanoid, OMA, EggNOG
Pig397399FCGRTFc fragment of IgG receptor and transporter9823OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.