Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Homeobox protein CDX-1 |
|---|
Gene and Protein Information
| Gene ID | 1044 |
|---|---|
| Uniprot Accession IDs | P47902 Q4VAU4 Q9NYK8 |
| Ensembl ID | ENSP00000231656 |
| Family | Belongs to the Caudal homeobox family. |
| Sequence | MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 471693 | CDX1 | caudal type homeobox 1 | 9598 | VGNC:11880 | OMA, EggNOG |
| Mouse | 12590 | Cdx1 | caudal type homeobox 1 | 10090 | MGI:88360 | Inparanoid, OMA, EggNOG |
| Dog | 612256 | CDX1 | caudal type homeobox 1 | 9615 | VGNC:39084 | Inparanoid, OMA, EggNOG |
| Pig | 100626275 | CDX1 | caudal type homeobox 1 | 9823 | OMA, EggNOG | |
| Opossum | 100024158 | CDX1 | caudal type homeobox 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 395397 | CDX1 | caudal type homeobox 1 | 9031 | CGNC:4232 | OMA, EggNOG |
| Anole lizard | 100564110 | cdx1 | caudal type homeobox 1 | 28377 | Inparanoid, EggNOG | |
| Xenopus | 395055 | cdx1 | caudal type homeobox 1 | 8364 | XB-GENE-485396 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-1
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-1
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-1
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.