🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

FCER1G

BeschreibungHigh affinity immunoglobulin epsilon receptor subunit gamma

Gene and Protein Information

Gene ID2207
Uniprot Accession IDs P30273 Q5VTW4
Ensembl ID ENSP00000289902
Symbol FCRG
FamilyBelongs to the CD3Z/FCER1G family.
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp100612300FCER1GFc fragment of IgE receptor Ig9598VGNC:6818OMA, EggNOG
Macaque720291FCER1GFc fragment of IgE receptor Ig9544Inparanoid, OMA, EggNOG
Mouse14127Fcer1gFc receptor, IgE, high affinity I, gamma polypeptide10090MGI:95496Inparanoid, OMA, EggNOG
Rat25441Fcer1gFc fragment of IgE receptor Ig10116RGD:2599Inparanoid, OMA, EggNOG
Dog403798FCER1GFc fragment of IgE receptor Ig9615VGNC:40802Inparanoid, OMA, EggNOG
Horse100034137FCER1GFc fragment of IgE receptor Ig9796VGNC:17973OMA, EggNOG
Cow282226FCER1GFc fragment of IgE receptor Ig9913VGNC:28931Inparanoid, OMA, EggNOG
Pig397406FCER1GFc fragment of IgE receptor Ig9823Inparanoid, OMA, EggNOG
OpossumFCER1GFc fragment of IgE receptor Ig [Source:HGNC Symbol;Acc:HGNC:3611]13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.