🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

HSPB6

BeschreibungHeat shock protein beta-6

Gene and Protein Information

Gene ID126393
Uniprot Accession IDs O14558 O14551 Q6NVI3 Q96MG9 HspB6
Ensembl ID ENSP00000468057
Symbol HEL55 Hsp20 PPP1R91
FamilyBelongs to the small heat shock protein (HSP20) family.
Sequence
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp745747HSPB6heat shock protein family B (small) member 69598VGNC:13182OMA, EggNOG
Macaque710760HSPB6heat shock protein family B (small) member 69544Inparanoid, OMA, EggNOG
Mouse243912Hspb6heat shock protein, alpha-crystallin-related, B610090MGI:2685325Inparanoid, OMA, EggNOG
Rat192245Hspb6heat shock protein family B (small) member 610116RGD:621554Inparanoid, OMA, EggNOG
Dog484574HSPB6heat shock protein family B (small) member 69615VGNC:53526Inparanoid, OMA, EggNOG
Horse100146605HSPB6heat shock protein family B (small) member 69796VGNC:51039Inparanoid, OMA, EggNOG
Cow534551HSPB6heat shock protein family B (small) member 69913Inparanoid, OMA, EggNOG
Pig494560HSPB6heat shock protein family B (small) member 69823OMA, EggNOG
OpossumHSPB6heat shock protein family B (small) member 6 [Source:HGNC Symbol;Acc:HGNC:26511]13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.