🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

IL10RB

BeschreibungInterleukin-10 receptor subunit beta

Gene and Protein Information

Gene ID3588
Uniprot Accession IDs Q08334 Q9BUU4 IL-10 receptor subunit beta
Ensembl ID ENSP00000290200
Symbol CRFB4 D21S58 D21S66 CRFB4 CRF2-4 D21S58 D21S66 CDW210B IL-10R2
FamilyBelongs to the type II cytokine receptor family.
Sequence
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp473966LOC473966interleukin-10 receptor subunit beta9598OMA, EggNOG
Mouse16155Il10rbinterleukin 10 receptor, beta10090MGI:109380Inparanoid, OMA, EggNOG
Rat304091Il10rbinterleukin 10 receptor subunit beta10116RGD:1560373Inparanoid, OMA, EggNOG
Dog100856489IL10RBinterleukin 10 receptor subunit beta9615Inparanoid, EggNOG
Horse100052549IL10RBinterleukin 10 receptor subunit beta9796OMA, EggNOG
Cow767864IL10RBinterleukin 10 receptor subunit beta9913Inparanoid, OMA, EggNOG
Opossum100026691IL10RBinterleukin 10 receptor subunit beta13616OMA, EggNOG
Anole lizard103281134LOC103281134interleukin-10 receptor subunit beta28377OMA, EggNOG
Zebrafish797527crfb4cytokine receptor family member b47955ZDB-GENE-070905-3OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    type II cytokine receptor    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    defense/immunity protein    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    type I cytokine receptor    /    Interleukin-10 receptor subunit beta
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Type II cytokine receptor    /    Interleukin-10 receptor subunit beta

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.