🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Mesoderm posterior protein 2 |
|---|
Gene and Protein Information
| Gene ID | 145873 |
|---|---|
| Uniprot Accession IDs | Q0VG99 Q7RTU2 |
| Ensembl ID | ENSP00000342392 |
| Symbol | BHLHC6 SCDO2 SCDO2 bHLHc6 |
| Sequence | MAQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQGQGQGQGQGQGQGQGQGQGQGQGQGRRPGLVSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWATPPYCPKIQSPPYSSQGTTSDASLWTPPQGCPWTQSSPEPRNPPVPWTAAPATLELAAVYQGLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPGRCWSHSAEVVPNSEDQGPGAAFQLSEASPPQSSGLRFSGCPELWQEDLEGARLGIFY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467757 | MESP2 | mesoderm posterior bHLH transcription factor 2 | 9598 | VGNC:1920 | OMA, EggNOG |
| Macaque | 701003 | MESP2 | mesoderm posterior bHLH transcription factor 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17293 | Mesp2 | mesoderm posterior 2 | 10090 | MGI:1096325 | Inparanoid, OMA, EggNOG |
| Rat | 293046 | Mesp2 | mesoderm posterior bHLH transcription factor 2 | 10116 | RGD:1305959 | Inparanoid, OMA, EggNOG |
| Dog | 100683170 | MESP2 | mesoderm posterior bHLH transcription factor 2 | 9615 | VGNC:43164 | Inparanoid, OMA, EggNOG |
| Cow | 615145 | MESP2 | mesoderm posterior bHLH transcription factor 2 | 9913 | VGNC:53945 | Inparanoid, OMA, EggNOG |
| Pig | 100153433 | MESP2 | mesoderm posterior bHLH transcription factor 2 | 9823 | OMA, EggNOG | |
| Opossum | 100015370 | MESP2 | mesoderm posterior bHLH transcription factor 2 | 13616 | Inparanoid, EggNOG | |
| Zebrafish | 58069 | mespaa | mesoderm posterior aa | 7955 | ZDB-GENE-000406-8 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.