AK1

BeschreibungAdenylate kinase isoenzyme 1

Gene and Protein Information

Gene ID203
Uniprot Accession IDs P00568 Q9BVK9 Q9UQC7 AK 1
Ensembl ID ENSP00000362271
Symbol HTL-S-58j
FamilyBelongs to the adenylate kinase family. AK1 subfamily.
Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp464756AK1adenylate kinase 19598VGNC:13849OMA, EggNOG
Mouse11636Ak1adenylate kinase 110090MGI:87977Inparanoid, OMA, EggNOG
Dog480712AK1adenylate kinase 19615VGNC:37745Inparanoid, OMA, EggNOG
Horse100070413AK1adenylate kinase 19796VGNC:15194Inparanoid, OMA, EggNOG
Cow280715AK1adenylate kinase 19913VGNC:25770Inparanoid, OMA, EggNOG
Pig100521423AK1adenylate kinase 19823Inparanoid, OMA, EggNOG
Opossum100011946AK1adenylate kinase 113616Inparanoid, EggNOG
Chicken396002AK1adenylate kinase 19031CGNC:49598Inparanoid, OMA
Anole lizard100561285ak1adenylate kinase 128377OMA, EggNOG
Zebrafish445486ak1adenylate kinase 17955ZDB-GENE-040822-37Inparanoid, OMA, EggNOG
C. elegans181317F38B2.4Adenylate kinase isoenzyme 16239Inparanoid, OMA, EggNOG
Fruitfly39396Adk1Adenylate kinase 17227FBgn0022709Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.